Description
Product name
Recombinant human EGF protein (Active)See all EGF proteins and peptidesBiological activity
Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant Proliferation of BALB / 3T3 cells is 0.99 ng/mL corresponding to a Specific Activity of 1.01 x 106IU/mg.
Purity
>= 95% SDS-PAGE.>= 95 % HPLC.Endotoxin level
<>Expression system
HEK 293 cellsAccession
P01133Protein length
Full length proteinAnimal free
YesCarrier free
YesNature
RecombinantSpecies
HumanSequence
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWW ELRPredicted molecular weight
6 kDaAmino acids
971 to 1023Additional sequence information
N-terminal glycine. Full-length mature EGF chain.
Associated products
Specifications
Our Abpromise guarantee covers the use ofab259398in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
- Applications
Mass Spectrometry
HPLC
SDS-PAGE
Cell Culture
Functional Studies
Form
LyophilizedAdditional notes
This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment
Concentration information loading...
Preparation and Storage
Stability and Storage
Shipped at Room Temperature. Store at Room Temperature.
Information available upon request.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
- ReconstitutionReconstitute with Phosphate Buffered saline.Reconstituted protein stable at -80C for 12 months or 4C for 1 week.
General Info
Alternative names
- Beta urogastrone
- beta-urogastrone
- EGF
see allFunction
EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro (PubMed:10964941).Tissue specificity
Expressed in kidney, salivary gland, cerebrum and prostate.Involvement in disease
Hypomagnesemia 4Sequence similarities
Contains 9 EGF-like domains.Contains 9 LDL-receptor class B repeats.Post-translationalmodifications
O-glycosylated with core 1-like and core 2-like glycans. It is uncertain if Ser-954 or Thr-955 is O-glycosylated. The modification here shows glycan heterogeneity: HexHexNAc (major) and Hex2HexNAc2 (minor).Cellular localization
Membrane.- Information by UniProt
