Description
Product name
Recombinant human FGF2 protein (Active)See all FGF2 proteins and peptidesBiological activity
Measured by its binding ability in a functional ELISA.Immobilized ab155734at 2 μg/mL (100 μL/well) can bind Human Glypican 3, Fc Tag (ab220538) with a linear range of 4-125 ng/mL.
Measured by its binding ability in a functional ELISA.Immobilized ab155734at 1 μg/mL (100 μL/well) can bind Human Glypican 1, Fc Tag with a linear range of 1-39 ng/mL.
Measured by its binding ability in an SPR assay. Immobilized ab155734 on CM5 Chip can bind Heparin with an affinity constant of 8.37 nM as determined in a SPR assay (Biacore T200).
Measured by its binding ability in a BLI assay.Loaded Biotinylated Heparin on SA Biosensor can bind ab155734 with an affinity constant of 1.88nM as determined in BLI assay (ForteBio Octet Red96e).
Purity
>95% SDS-PAGE.ab155734 was lyophilised from 0.22 µm filtered solution.Endotoxin level
<>Expression system
Escherichia coliAccession
P09038Protein length
Full length proteinAnimal free
NoNature
RecombinantSpecies
HumanSequence
PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPH IKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLES NNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKSPredicted molecular weight
17 kDaAmino acids
143 to 288
Associated products
Specifications
Our Abpromise guarantee covers the use ofab155734in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
- Applications
ELISA
Functional Studies
SDS-PAGE
Form
LyophilizedAdditional notes
The product is stable after storage at:
- -20 to -70oC for 12 months in lyophilized state;
- -70oC for 3 months under sterile conditions after reconstitution.
Concentration information loading...
Preparation and Storage
Stability and Storage
Shipped at Room Temperature. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40Constituents: 95% PBS, 5% Trehalose
This product is an active protein and may elicit a biological response in vivo, handle with caution.
- ReconstitutionIt is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 200 ug/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.
General Info
Alternative names
- Basic fibroblast growth factor
- Basic fibroblast growth factor bFGF
- BFGF
see allFunction
Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis (PubMed:23469107).Tissue specificity
Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non-cancerous liver tissue.Sequence similarities
Belongs to the heparin-binding growth factors family.Post-translationalmodifications
Phosphorylation at Tyr-215 regulates FGF2 unconventional secretion.Several N-termini starting at positions 94, 125, 126, 132, 143 and 162 have been identified by direct sequencing.Cellular localization
Secreted. Nucleus. Exported from cells by an endoplasmic reticulum (ER)/Golgi-independent mechanism. Unconventional secretion of FGF2 occurs by direct translocation across the plasma membrane. Binding of exogenous FGF2 to FGFR facilitates endocytosis followed by translocation of FGF2 across endosomal membrane into the cytosol. Nuclear import from the cytosol requires the classical nuclear import machinery, involving proteins KPNA1 and KPNB1, as well as CEP57.- Information by UniProt
