Description
Product name
Recombinant Human Interferon gamma protein (Active)See all Interferon gamma proteins and peptidesBiological activity
Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant Killing/apoptosis of HT-29 cells is 0.34 ng/mL corresponding to a Specific Activity of 2.94 x 106IU/mg.
Purity
>= 95% SDS-PAGE.>= 95 % HPLC.Endotoxin level
<>Expression system
HEK 293 cellsAccession
P01579Protein length
Full length proteinAnimal free
YesCarrier free
YesNature
RecombinantSpecies
HumanSequence
QDPYVQEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIV SFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSV TDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQPredicted molecular weight
17 kDaAmino acids
24 to 166Additional sequence information
Full length protein including propeptide. N-terminal Glycine
Description
Recombinant human Interferon gamma protein (Active)
Associated products
Specifications
Our Abpromise guarantee covers the use ofab259377in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
- Applications
Mass Spectrometry
Cell Culture
HPLC
SDS-PAGE
Functional Studies
Form
LyophilizedAdditional notes
This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment
Concentration information loading...
Preparation and Storage
Stability and Storage
Shipped at Room Temperature. Store at Room Temperature.
Information available upon request.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
- ReconstitutionReconstitute with Phosphate Buffered Saline.Reconstituted protein stable at -80C for 12 months or 4C for 1 week.
General Info
Alternative names
- IF 1
- IFG
- IFI
see allFunction
Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.Tissue specificity
Released primarily from activated T lymphocytes.Involvement in disease
In Caucasians, genetic variation in IFNG is associated with the risk of aplastic anemia (AA) [MIM:609135]. AA is a rare disease in which the reduction of the circulating blood cells results from damage to the stem cell pool in bone marrow. In most patients, the stem cell lesion is caused by an autoimmune attack. T-lymphocytes, activated by an endogenous or exogenous, and most often unknown antigenic stimulus, secrete cytokines, including IFN-gamma, which would in turn be able to suppress hematopoiesis.Sequence similarities
Belongs to the type II (or gamma) interferon family.Post-translationalmodifications
Proteolytic processing produces C-terminal heterogeneity, with proteins ending alternatively at Gly-150, Met-157 or Gly-161.Cellular localization
Secreted.- Information by UniProt
