
Description
Product name
Recombinant human CD137 protein (Fc Chimera Active)See all CD137 proteins and peptidesBiological activity
Measured by its binding ability in ELISA.Immobilized ab220584at 0.1 μg/mL (100 μL/well) can bindRecombinant human 4-1BBL protein (Fc Chimera Active) (Biotin) (ab246043)with a linear range of 0.4-13 ng/mL.
Measured by its binding ability in FACS.Flow Cytometry assay shows thatab220584 can bind to 293T cells overexpressing Human 4-1BBL. The concentration of 4-1BB used is 0.1 μg/mL.
Measured by its binding ability in BLI assay.Loadedab220584 on Protein A Biosensor, can bindRecombinant human 4-1BBL protein (Fc Chimera Active) (Biotin) (ab246043) with an affinity constant of 1.3 nM.
Purity
>95% SDS-PAGE.Endotoxin level
<>Expression system
HEK 293 cellsAccession
Q07011Protein length
Protein fragmentAnimal free
NoNature
RecombinantSpecies
HumanSequence
LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFR TRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFG TFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVT PPAPAREPGHSPQPredicted molecular weight
43 kDa including tagsAmino acids
24 to 186Tags
Fc tag C-TerminusAdditional sequence information
Extracellular domain fused with a human IgG1 Fc tag (Pro 100 - Lys 330; P01857) at the C-terminus.
Associated products
Related Products
- Anti-CD137 antibody (ab203391)
Specifications
Our Abpromise guarantee covers the use ofab220584in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
- Applications
SDS-PAGE
Functional Studies
ELISA
Flow Cytometry
Form
LyophilizedAdditional notes
This product is stable after storage at:
- -20°C to -70°C for 12 months in lyophilized state;
- -70°C for 3 months under sterile conditions after reconstitution.
Concentration information loading...
Preparation and Storage
Stability and Storage
Shipped at Room Temperature. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.4Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, L-Arginine, Sodium chloride
This product is an active protein and may elicit a biological response in vivo, handle with caution.
- ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
Alternative names
- 4 1BB
- 4 1BB ligand receptor
- 4-1BB ligand receptor
see allFunction
Receptor for TNFSF14/4-1BBL. Possibly active during T cell activation.Tissue specificity
Expressed on the surface of activated T-cells.Sequence similarities
Contains 4 TNFR-Cys repeats.Cellular localization
Membrane.- Information by UniProt