Description
Product name
Recombinant human SIRP alpha protein (Fc Chimera Active)See all SIRP alpha proteins and peptidesBiological activity
Measured by its binding ability in a functional ELISA. Recombinant human CD47 protein (Active) (ab174029) at 2µg/mL (100µL/well) can bind ab221342 with a linear range of 4-31 ng/mL.
Measured by its binding ability in a functional ELISA. Serial dilutions of Anti-Human CD47 Neutralizing Antibody were added into ab221342: Recombinant human CD47 protein (Fc Chimera Active) (Biotin) (ab246018) binding reactions. The half maximal inhibitory concentration (IC50) is 0.2006µg/mL.
Measured by its binding ability inFACS.The binding ofab221342 to Jurkat expressing CD47 was inhibited by increasing concentration of neutralizing anti-CD47 antibody. The concentration of SIRP alpha used is 0.3 µg/ml. IC50=0.1318 µg/ml.
Measured by its binding ability inFACS. Recombinantab221342 can bind to Jurkat cell expressing CD47. The concentration of SIRP alpha used is 0.3 µg/ml.
Purity
>95% SDS-PAGE.>90% pure as determined by SEC-HPLC.Endotoxin level
<>Expression system
HEK 293 cellsAccession
P78324Protein length
Protein fragmentAnimal free
NoNature
RecombinantSpecies
HumanSequence
EEELQVIQPDKSVLVAAGETATLRCTATSLIPVGPIQWFRGAGPGRELIY NQKEGHFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPD DVEFKSGAGTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDI TLKWFKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEV AHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRKFYP QRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSAHRDDVKLT CQVEHDGQPAVSKSHDLKVSAHPKEQGSNTAAENTGSNERPredicted molecular weight
64 kDa including tagsAmino acids
31 to 370Tags
Fc tag C-TerminusAdditional sequence information
This protein carries a mouse IgG1 Fc tag at the C-terminus (Val 98-Lys 324; AAK53870.1). (NP_001035111).
Associated products
Related Products
- Anti-SIRP alpha antibody (ab126157)
Specifications
Our Abpromise guarantee covers the use ofab221342in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
- Applications
Flow Cytometry
ELISA
SDS-PAGE
HPLC
Functional Studies
Form
LyophilizedAdditional notes
This product is stable after storage at:
- -20°C to -70°C for 12 months in lyophilized state;
- -70°C for 3 months under sterile conditions after reconstitution.
Concentration information loading...
Preparation and Storage
Stability and Storage
Shipped at Room Temperature. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.4Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose
This product is an active protein and may elicit a biological response in vivo, handle with caution.
- ReconstitutionReconstitute with sterile deionized water to a concentration of 500 µg/ml.
General Info
Alternative names
- Signal regulatory protein alpha type 1
- Bit
- Brain Ig like molecule with tyrosine based activation motifs
see allFunction
Immunoglobulin-like cell surface receptor for CD47. Acts as docking protein and induces translocation of PTPN6, PTPN11 and other binding partners from the cytosol to the plasma membrane. Supports adhesion of cerebellar neurons, neurite outgrowth and glial cell attachment. May play a key role in intracellular signaling during synaptogenesis and in synaptic function (By similarity). Involved in the negative regulation of receptor tyrosine kinase-coupled cellular responses induced by cell adhesion, growth factors or insulin. Mediates negative regulation of phagocytosis, mast cell activation and dendritic cell activation. CD47 binding prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells.Tissue specificity
Ubiquitous. Highly expressed in brain. Detected on myeloid cells, but not T-cells. Detected at lower levels in heart, placenta, lung, testis, ovary, colon, liver, small intestine, prostate, spleen, kidney, skeletal muscle and pancreas.Sequence similarities
Contains 2 Ig-like C1-type (immunoglobulin-like) domains.Contains 1 Ig-like V-type (immunoglobulin-like) domain.Post-translationalmodifications
N-glycosylated.Phosphorylated on tyrosine residues in response to stimulation with EGF, growth hormone, insulin and PDGF. Dephosphorylated by PTPN11.Cellular localization
Membrane.- Information by UniProt
